Lineage for d3dp8c1 (3dp8 C:4-499)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 846191Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 846192Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 846193Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins)
  6. 846645Protein Nickel-binding periplasmic protein NikA [102694] (1 species)
    similar domain organization to oligo- and dipeptide-binding protein
  7. 846646Species Escherichia coli [TaxId:562] [102695] (5 PDB entries)
  8. 846655Domain d3dp8c1: 3dp8 C:4-499 [157823]
    automatically matched to d1zlqa1
    complexed with act, cl, gol, hct, ni, so4

Details for d3dp8c1

PDB Entry: 3dp8 (more details), 2.5 Å

PDB Description: Structural characterization of a putative endogenous metal chelator in the periplasmic nickel transporter NikA (nickel butane-1,2,4-tricarboxylate form)
PDB Compounds: (C:) Nickel-binding periplasmic protein

SCOP Domain Sequences for d3dp8c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dp8c1 c.94.1.1 (C:4-499) Nickel-binding periplasmic protein NikA {Escherichia coli [TaxId: 562]}
deittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedgktw
tftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqitlk
sayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvrnen
ywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayhtqls
qpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpyanl
glkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeiiqad
mrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpshadfqaqq
gladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpelgni
pyapiateipfeqikp

SCOP Domain Coordinates for d3dp8c1:

Click to download the PDB-style file with coordinates for d3dp8c1.
(The format of our PDB-style files is described here.)

Timeline for d3dp8c1: