Lineage for d3dolb_ (3dol B:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2220074Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2220075Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2220424Family e.8.1.2: Reverse transcriptase [56686] (3 protein domains)
  6. 2220425Protein HIV-1 reverse transcriptase [56689] (4 species)
  7. 2220467Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (172 PDB entries)
    Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595
  8. 2220507Domain d3dolb_: 3dol B: [157820]
    Other proteins in same PDB: d3dola2
    automated match to d1c1cb_
    complexed with gwi, po4; mutant

Details for d3dolb_

PDB Entry: 3dol (more details), 2.5 Å

PDB Description: Crystal structure of L100I mutant HIV-1 reverse transcriptase in complex with GW695634.
PDB Compounds: (B:) p66 RT

SCOPe Domain Sequences for d3dolb_:

Sequence, based on SEQRES records: (download)

>d3dolb_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
ietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaik
kkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpldedf
rkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqym
ddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvqpi
vlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeaelela
enreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtnd
vkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplvk
lwyqlek

Sequence, based on observed residues (ATOM records): (download)

>d3dolb_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
ietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaik
dstkwrklvdfrelnkrtqdfwgiphpaglkkkksvtvldvgdayfsvpldedfrkytaf
tipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqymddlyvg
sdleigqhrtkieelrqhllrwglttelhpdkwtvqpivlpekdswtvndiqklvgklnw
asqiypgikvrqlckllrgtkalteviplteeaelelaenreilkepvhgvyydpskdli
aeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtndvkqlteavqkittesiviwgkt
pkfklpiqketwetwwteywqatwipewefvntpplvklwyqlek

SCOPe Domain Coordinates for d3dolb_:

Click to download the PDB-style file with coordinates for d3dolb_.
(The format of our PDB-style files is described here.)

Timeline for d3dolb_: