Lineage for d3dmtd2 (3dmt D:165-333)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1033075Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 1033076Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 1033077Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 1033131Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)
  7. 1033329Species Trypanosoma cruzi [TaxId:5693] [75483] (4 PDB entries)
  8. 1033337Domain d3dmtd2: 3dmt D:165-333 [157814]
    Other proteins in same PDB: d3dmta1, d3dmtb1, d3dmtc1, d3dmtd1
    automatically matched to d1k3ta2
    complexed with gol, nad

Details for d3dmtd2

PDB Entry: 3dmt (more details), 2.3 Å

PDB Description: structure of glycosomal glyceraldehyde-3-phosphate dehydrogenase from trypanosoma cruzi in complex with the irreversible iodoacetate inhibitor
PDB Compounds: (D:) glyceraldehyde-3-phosphate dehydrogenase, glycosomal

SCOPe Domain Sequences for d3dmtd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dmtd2 d.81.1.1 (D:165-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]}
scttnclapivhvlvkegfgvqtglmttihsytatqktvdgvsvkdwrggraaavniips
ttgaakavgmvipstqgkltgmsfrvptpdvsvvdltftaardtsiqeidaalkraskty
mkgilgytdeelvsadfindnrssiydskatlqnnlpkerrffkivswy

SCOPe Domain Coordinates for d3dmtd2:

Click to download the PDB-style file with coordinates for d3dmtd2.
(The format of our PDB-style files is described here.)

Timeline for d3dmtd2: