| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) ![]() N-terminal domain is the classic Rossmann-fold |
| Family d.81.1.1: GAPDH-like [55348] (6 proteins) has many additional secondary structures |
| Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species) |
| Species Trypanosoma cruzi [TaxId:5693] [75483] (4 PDB entries) |
| Domain d3dmtc2: 3dmt C:165-333 [157812] Other proteins in same PDB: d3dmta1, d3dmtb1, d3dmtc1, d3dmtd1 automatically matched to d1k3ta2 complexed with gol, nad |
PDB Entry: 3dmt (more details), 2.3 Å
SCOP Domain Sequences for d3dmtc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dmtc2 d.81.1.1 (C:165-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]}
scttnclapivhvlvkegfgvqtglmttihsytatqktvdgvsvkdwrggraaavniips
ttgaakavgmvipstqgkltgmsfrvptpdvsvvdltftaardtsiqeidaalkraskty
mkgilgytdeelvsadfindnrssiydskatlqnnlpkerrffkivswy
Timeline for d3dmtc2: