SCOPe 2.08: Domain d3dmtc2: 3dmt C:165-333

Lineage for d3dmtc2 (3dmt C:165-333)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (6 proteins)
   has many additional secondary structures

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (21 species)

7. Species Trypanosoma cruzi [TaxId:5693] [75483] (5 PDB entries)

8. Domain d3dmtc2: 3dmt C:165-333 [157812]
   Other proteins in same PDB: d3dmta1, d3dmtb1, d3dmtc1, d3dmtd1
   automated match to d1k3ta2
   complexed with gol, nad

Details for d3dmtc2

PDB Entry: 3dmt, 2.3 Å

PDB Description: structure of glycosomal glyceraldehyde-3-phosphate dehydrogenase from trypanosoma cruzi in complex with the irreversible iodoacetate inhibitor

PDB Compounds: (C:) glyceraldehyde-3-phosphate dehydrogenase, glycosomal

SCOPe Domain Sequences for d3dmtc2:

Sequence; same for both SEQRES and ATOM records:

>d3dmtc2 d.81.1.1 (C:165-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]}
scttnclapivhvlvkegfgvqtglmttihsytatqktvdgvsvkdwrggraaavniips
ttgaakavgmvipstqgkltgmsfrvptpdvsvvdltftaardtsiqeidaalkraskty
mkgilgytdeelvsadfindnrssiydskatlqnnlpkerrffkivswy

Timeline for d3dmtc2:

• d3dmtc2 first appeared in SCOP 1.75
  
• d3dmtc2 appears in SCOPe 2.07