![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
![]() | Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (21 species) |
![]() | Species Trypanosoma cruzi [TaxId:5693] [75104] (5 PDB entries) |
![]() | Domain d3dmtc1: 3dmt C:1-164,C:334-359 [157811] Other proteins in same PDB: d3dmta2, d3dmtb2, d3dmtc2, d3dmtd2 automated match to d1k3ta1 complexed with gol, nad |
PDB Entry: 3dmt (more details), 2.3 Å
SCOPe Domain Sequences for d3dmtc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dmtc1 c.2.1.3 (C:1-164,C:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} mpikvgingfgrigrmvfqalcedgllgteidvvavvdmntdaeyfayqmrydtvhgkfk yevtttksspsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftakaaa eghlrggarkvvisapasggaktlvmgvnhheynpsehhvvsnaXdnewgyshrvvdlvr hmaskdrsarl
Timeline for d3dmtc1: