Lineage for d3dmcb_ (3dmc B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1019632Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1020039Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1020475Family d.17.4.10: PhzA/PhzB-like [102813] (4 proteins)
  6. 1020482Protein Uncharacterized protein Ava2261 [159975] (1 species)
  7. 1020483Species Anabaena variabilis [TaxId:1172] [159976] (1 PDB entry)
    Uniprot Q3MAV7 1-133
  8. 1020485Domain d3dmcb_: 3dmc B: [157806]
    automated match to d3dmca1
    complexed with act

Details for d3dmcb_

PDB Entry: 3dmc (more details), 1.65 Å

PDB Description: crystal structure of a ntf2-like protein (ava_2261) from anabaena variabilis atcc 29413 at 1.65 a resolution
PDB Compounds: (B:) NTF2-like Protein

SCOPe Domain Sequences for d3dmcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dmcb_ d.17.4.10 (B:) Uncharacterized protein Ava2261 {Anabaena variabilis [TaxId: 1172]}
gmmthysdntlkvahqgfefftqglatgewqkfldmltedftfwfpmgefhglnvgkera
kefftyvsesfhtgiqissldrvtsnettvvfefrdeglflgkpyknrvavsfdvrgdki
csyreyfgsdgksn

SCOPe Domain Coordinates for d3dmcb_:

Click to download the PDB-style file with coordinates for d3dmcb_.
(The format of our PDB-style files is described here.)

Timeline for d3dmcb_: