Lineage for d3dmcb1 (3dmc B:1-133)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 855301Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 855675Superfamily d.17.4: NTF2-like [54427] (30 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 855976Family d.17.4.10: PhzA/PhzB-like [102813] (4 proteins)
  6. 855983Protein Uncharacterized protein Ava2261 [159975] (1 species)
  7. 855984Species Anabaena variabilis [TaxId:1172] [159976] (1 PDB entry)
    Uniprot Q3MAV7 1-133
  8. 855986Domain d3dmcb1: 3dmc B:1-133 [157806]
    automatically matched to 3DMC A:1-133
    complexed with act

Details for d3dmcb1

PDB Entry: 3dmc (more details), 1.65 Å

PDB Description: crystal structure of a ntf2-like protein (ava_2261) from anabaena variabilis atcc 29413 at 1.65 a resolution
PDB Compounds: (B:) NTF2-like Protein

SCOP Domain Sequences for d3dmcb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dmcb1 d.17.4.10 (B:1-133) Uncharacterized protein Ava2261 {Anabaena variabilis [TaxId: 1172]}
mmthysdntlkvahqgfefftqglatgewqkfldmltedftfwfpmgefhglnvgkerak
efftyvsesfhtgiqissldrvtsnettvvfefrdeglflgkpyknrvavsfdvrgdkic
syreyfgsdgksn

SCOP Domain Coordinates for d3dmcb1:

Click to download the PDB-style file with coordinates for d3dmcb1.
(The format of our PDB-style files is described here.)

Timeline for d3dmcb1: