![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.20: Rpa4348-like [160007] (2 proteins) PfamB PB000085 |
![]() | Protein Uncharacterized protein Rpa4348 [160010] (1 species) |
![]() | Species Rhodopseudomonas palustris [TaxId:1076] [160011] (1 PDB entry) Uniprot Q6N1Q6 1-135 |
![]() | Domain d3dm8a1: 3dm8 A:1-135 [157804] complexed with ce9 |
PDB Entry: 3dm8 (more details), 1.8 Å
SCOPe Domain Sequences for d3dm8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dm8a1 d.17.4.20 (A:1-135) Uncharacterized protein Rpa4348 {Rhodopseudomonas palustris [TaxId: 1076]} mtehslwrfsralhralndrqteelatiiddnidwaiygpidmfpffgarqgkaavlevc rqiadsvriyryhresvmlgidsaasmvrysltaagtnrpisvrmalftqfqngrltnlr mvldtfdlveqalgr
Timeline for d3dm8a1: