Lineage for d3dm8a1 (3dm8 A:1-135)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2937066Family d.17.4.20: Rpa4348-like [160007] (2 proteins)
    PfamB PB000085
  6. 2937070Protein Uncharacterized protein Rpa4348 [160010] (1 species)
  7. 2937071Species Rhodopseudomonas palustris [TaxId:1076] [160011] (1 PDB entry)
    Uniprot Q6N1Q6 1-135
  8. 2937072Domain d3dm8a1: 3dm8 A:1-135 [157804]
    complexed with ce9

Details for d3dm8a1

PDB Entry: 3dm8 (more details), 1.8 Å

PDB Description: crystal structure of putative isomerase from rhodopseudomonas palustris
PDB Compounds: (A:) uncharacterized protein RPA4348

SCOPe Domain Sequences for d3dm8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dm8a1 d.17.4.20 (A:1-135) Uncharacterized protein Rpa4348 {Rhodopseudomonas palustris [TaxId: 1076]}
mtehslwrfsralhralndrqteelatiiddnidwaiygpidmfpffgarqgkaavlevc
rqiadsvriyryhresvmlgidsaasmvrysltaagtnrpisvrmalftqfqngrltnlr
mvldtfdlveqalgr

SCOPe Domain Coordinates for d3dm8a1:

Click to download the PDB-style file with coordinates for d3dm8a1.
(The format of our PDB-style files is described here.)

Timeline for d3dm8a1: