Lineage for d3dlqi_ (3dlq I:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 912412Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 912413Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 912635Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
    contains an additional helix in one of the crossover connections
  6. 912702Protein Interleukin-22 (IL-22) [89036] (1 species)
  7. 912703Species Human (Homo sapiens) [TaxId:9606] [89037] (5 PDB entries)
  8. 912704Domain d3dlqi_: 3dlq I: [157802]
    automated match to d1m4ra_

Details for d3dlqi_

PDB Entry: 3dlq (more details), 1.9 Å

PDB Description: crystal structure of the il-22/il-22r1 complex
PDB Compounds: (I:) Interleukin-22

SCOPe Domain Sequences for d3dlqi_:

Sequence, based on SEQRES records: (download)

>d3dlqi_ a.26.1.3 (I:) Interleukin-22 (IL-22) {Human (Homo sapiens) [TaxId: 9606]}
arldksnfqqpyitnrtfmlakeasladnntdvrligeklfhgvsmsercylmkqvlnft
leevlfpqsdrfqpymqevvpflarlsnrlstchiegddlhiqrnvqklkdtvkklgesg
eikaigeldllfmslrnaci

Sequence, based on observed residues (ATOM records): (download)

>d3dlqi_ a.26.1.3 (I:) Interleukin-22 (IL-22) {Human (Homo sapiens) [TaxId: 9606]}
arldksnfqqpyitnrtfmlakeasladnntdvrligeklfhgvsmsercylmkqvlnft
leevlfpqsdrfqpymqevvpflarlsnrlshiqrnvqklkdtvkklgesgeikaigeld
llfmslrnaci

SCOPe Domain Coordinates for d3dlqi_:

Click to download the PDB-style file with coordinates for d3dlqi_.
(The format of our PDB-style files is described here.)

Timeline for d3dlqi_: