Class a: All alpha proteins [46456] (284 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (3 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins) contains an additional helix in one of the crossover connections |
Protein Interleukin-22 (IL-22) [89036] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [89037] (5 PDB entries) |
Domain d3dlqi_: 3dlq I: [157802] automated match to d1m4ra_ |
PDB Entry: 3dlq (more details), 1.9 Å
SCOPe Domain Sequences for d3dlqi_:
Sequence, based on SEQRES records: (download)
>d3dlqi_ a.26.1.3 (I:) Interleukin-22 (IL-22) {Human (Homo sapiens) [TaxId: 9606]} arldksnfqqpyitnrtfmlakeasladnntdvrligeklfhgvsmsercylmkqvlnft leevlfpqsdrfqpymqevvpflarlsnrlstchiegddlhiqrnvqklkdtvkklgesg eikaigeldllfmslrnaci
>d3dlqi_ a.26.1.3 (I:) Interleukin-22 (IL-22) {Human (Homo sapiens) [TaxId: 9606]} arldksnfqqpyitnrtfmlakeasladnntdvrligeklfhgvsmsercylmkqvlnft leevlfpqsdrfqpymqevvpflarlsnrlshiqrnvqklkdtvkklgesgeikaigeld llfmslrnaci
Timeline for d3dlqi_: