Lineage for d3dlqi1 (3dlq I:41-179)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 767022Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 767023Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 767210Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (8 proteins)
    contains an additional helix in one of the crossover connections
  6. 767279Protein Interleukin-22 (IL-22) [89036] (1 species)
  7. 767280Species Human (Homo sapiens) [TaxId:9606] [89037] (3 PDB entries)
  8. 767281Domain d3dlqi1: 3dlq I:41-179 [157802]
    automatically matched to d1m4ra_
    mutant

Details for d3dlqi1

PDB Entry: 3dlq (more details), 1.9 Å

PDB Description: crystal structure of the il-22/il-22r1 complex
PDB Compounds: (I:) Interleukin-22

SCOP Domain Sequences for d3dlqi1:

Sequence, based on SEQRES records: (download)

>d3dlqi1 a.26.1.3 (I:41-179) Interleukin-22 (IL-22) {Human (Homo sapiens) [TaxId: 9606]}
rldksnfqqpyitnrtfmlakeasladnntdvrligeklfhgvsmsercylmkqvlnftl
eevlfpqsdrfqpymqevvpflarlsnrlstchiegddlhiqrnvqklkdtvkklgesge
ikaigeldllfmslrnaci

Sequence, based on observed residues (ATOM records): (download)

>d3dlqi1 a.26.1.3 (I:41-179) Interleukin-22 (IL-22) {Human (Homo sapiens) [TaxId: 9606]}
rldksnfqqpyitnrtfmlakeasladnntdvrligeklfhgvsmsercylmkqvlnftl
eevlfpqsdrfqpymqevvpflarlsnrlshiqrnvqklkdtvkklgesgeikaigeldl
lfmslrnaci

SCOP Domain Coordinates for d3dlqi1:

Click to download the PDB-style file with coordinates for d3dlqi1.
(The format of our PDB-style files is described here.)

Timeline for d3dlqi1: