SCOPe 2.03: Domain d3dllw1: 3dll W:1-55

Lineage for d3dllw1 (3dll W:1-55)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
   core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold

4. Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family)

5. Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins)

6. Protein Prokaryotic ribosomal protein L30 [55131] (3 species)
   short-chain member of the family

7. Species Deinococcus radiodurans [TaxId:1299] [160396] (6 PDB entries)
   Uniprot Q9RSL0 1-55

8. Domain d3dllw1: 3dll W:1-55 [157800]
   Other proteins in same PDB: d3dll11, d3dll21, d3dll31, d3dll41, d3dllb1, d3dllc1, d3dlld1, d3dlle1, d3dlle2, d3dllg1, d3dllh1, d3dlli1, d3dllj1, d3dllk1, d3dlll1, d3dllm1, d3dlln1, d3dllo1, d3dllp1, d3dllq1, d3dllr1, d3dlls1, d3dllt1, d3dllu1, d3dllv1, d3dlly1
   automatically matched to 2ZJR W:1-55
   complexed with mg, zld, zn

Details for d3dllw1

PDB Entry: 3dll, 3.5 Å

PDB Description: the oxazolidinone antibiotics perturb the ribosomal peptidyl- transferase center and effect trna positioning

PDB Compounds: (W:) 50S ribosomal protein L30

SCOPe Domain Sequences for d3dllw1:

Sequence; same for both SEQRES and ATOM records:

>d3dllw1 d.59.1.1 (W:1-55) Prokaryotic ribosomal protein L30 {Deinococcus radiodurans [TaxId: 1299]}
mkiklvrsvigrpgnqvktvqalglrkigdsrevsdtpavrgmvktvkhllevqe

Timeline for d3dllw1:

• d3dllw1 first appeared in SCOP 1.75
  
• d3dllw1 appears in SCOPe 2.02
  
• d3dllw1 appears in SCOPe 2.04
  
• d3dllw1 appears in the current release, SCOPe 2.08