Lineage for d3dllt1 (3dll T:2-85)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2082731Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2083045Superfamily b.84.4: Ribosomal L27 protein-like [110324] (3 families) (S)
    rudiment single hybrid fold with a permuted topology
  5. 2083046Family b.84.4.1: Ribosomal L27 protein [110325] (1 protein)
    Pfam PF01016
  6. 2083047Protein Ribosomal protein L27 [110326] (3 species)
  7. 2083048Species Deinococcus radiodurans [TaxId:1299] [159323] (7 PDB entries)
    Uniprot Q9RY65 2-85
  8. 2083051Domain d3dllt1: 3dll T:2-85 [157797]
    Other proteins in same PDB: d3dll11, d3dll21, d3dll31, d3dll41, d3dllb1, d3dllc1, d3dlld1, d3dlle1, d3dlle2, d3dllg1, d3dllh1, d3dlli1, d3dllj1, d3dllk1, d3dlll1, d3dllm1, d3dlln1, d3dllo1, d3dllp1, d3dllq1, d3dllr1, d3dlls1, d3dllu1, d3dllv1, d3dllw1, d3dlly1
    automatically matched to 2ZJR T:2-85
    complexed with mg, zld, zn

Details for d3dllt1

PDB Entry: 3dll (more details), 3.5 Å

PDB Description: the oxazolidinone antibiotics perturb the ribosomal peptidyl- transferase center and effect trna positioning
PDB Compounds: (T:) 50S ribosomal protein L27

SCOPe Domain Sequences for d3dllt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dllt1 b.84.4.1 (T:2-85) Ribosomal protein L27 {Deinococcus radiodurans [TaxId: 1299]}
ahkkgvgsskngrdsnpkylgvkkfggevvkagnilvrqrgtkfkagqgvgmgrdhtlfa
lsdgkvvfinkgkgarfisieaaq

SCOPe Domain Coordinates for d3dllt1:

Click to download the PDB-style file with coordinates for d3dllt1.
(The format of our PDB-style files is described here.)

Timeline for d3dllt1: