SCOPe 2.03: Domain d3dllt1: 3dll T:2-85

Lineage for d3dllt1 (3dll T:2-85)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.4: Ribosomal L27 protein-like [110324] (2 families)
   rudiment single hybrid fold with a permuted topology

5. Family b.84.4.1: Ribosomal L27 protein [110325] (1 protein)
   Pfam PF01016

6. Protein Ribosomal protein L27 [110326] (3 species)

7. Species Deinococcus radiodurans [TaxId:1299] [159323] (7 PDB entries)
   Uniprot Q9RY65 2-85

8. Domain d3dllt1: 3dll T:2-85 [157797]
   Other proteins in same PDB: d3dll11, d3dll21, d3dll31, d3dll41, d3dllb1, d3dllc1, d3dlld1, d3dlle1, d3dlle2, d3dllg1, d3dllh1, d3dlli1, d3dllj1, d3dllk1, d3dlll1, d3dllm1, d3dlln1, d3dllo1, d3dllp1, d3dllq1, d3dllr1, d3dlls1, d3dllu1, d3dllv1, d3dllw1, d3dlly1
   automatically matched to 2ZJR T:2-85
   complexed with mg, zld, zn

Details for d3dllt1

PDB Entry: 3dll, 3.5 Å

PDB Description: the oxazolidinone antibiotics perturb the ribosomal peptidyl- transferase center and effect trna positioning

PDB Compounds: (T:) 50S ribosomal protein L27

SCOPe Domain Sequences for d3dllt1:

Sequence; same for both SEQRES and ATOM records:

>d3dllt1 b.84.4.1 (T:2-85) Ribosomal protein L27 {Deinococcus radiodurans [TaxId: 1299]}
ahkkgvgsskngrdsnpkylgvkkfggevvkagnilvrqrgtkfkagqgvgmgrdhtlfa
lsdgkvvfinkgkgarfisieaaq

Timeline for d3dllt1:

• d3dllt1 first appeared in SCOP 1.75
  
• d3dllt1 appears in SCOPe 2.02
  
• d3dllt1 appears in SCOPe 2.04
  
• d3dllt1 appears in the current release, SCOPe 2.08