Class b: All beta proteins [48724] (174 folds) |
Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.4: Ribosomal L27 protein-like [110324] (2 families) rudiment single hybrid fold with a permuted topology |
Family b.84.4.1: Ribosomal L27 protein [110325] (1 protein) Pfam PF01016 |
Protein Ribosomal protein L27 [110326] (3 species) |
Species Deinococcus radiodurans [TaxId:1299] [159323] (11 PDB entries) Uniprot Q9RY65 2-85 |
Domain d3dllt1: 3dll T:2-85 [157797] Other proteins in same PDB: d3dll11, d3dll21, d3dll31, d3dll41, d3dllb1, d3dllc1, d3dlld1, d3dlle1, d3dlle2, d3dllg1, d3dllh1, d3dlli1, d3dllj1, d3dllk1, d3dlll1, d3dllm1, d3dlln1, d3dllo1, d3dllp1, d3dllq1, d3dllr1, d3dlls1, d3dllu1, d3dllv1, d3dllw1, d3dlly1 automatically matched to 2ZJR T:2-85 complexed with mg, zld, zn |
PDB Entry: 3dll (more details), 3.5 Å
SCOPe Domain Sequences for d3dllt1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dllt1 b.84.4.1 (T:2-85) Ribosomal protein L27 {Deinococcus radiodurans [TaxId: 1299]} ahkkgvgsskngrdsnpkylgvkkfggevvkagnilvrqrgtkfkagqgvgmgrdhtlfa lsdgkvvfinkgkgarfisieaaq
Timeline for d3dllt1:
View in 3D Domains from other chains: (mouse over for more information) d3dll11, d3dll21, d3dll31, d3dll41, d3dllb1, d3dllc1, d3dlld1, d3dlle1, d3dlle2, d3dllg1, d3dllh1, d3dlli1, d3dllj1, d3dllk1, d3dlll1, d3dllm1, d3dlln1, d3dllo1, d3dllp1, d3dllq1, d3dllr1, d3dlls1, d3dllu1, d3dllv1, d3dllw1, d3dlly1 |