Lineage for d3dllr1 (3dll R:4-113)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2054645Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 2054646Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)
  6. 2054689Protein Ribosomal proteins L24 (L24p) [50106] (4 species)
  7. 2054690Species Deinococcus radiodurans [TaxId:1299] [159024] (7 PDB entries)
    Uniprot Q9RXJ1 4-113
  8. 2054692Domain d3dllr1: 3dll R:4-113 [157795]
    Other proteins in same PDB: d3dll11, d3dll21, d3dll31, d3dll41, d3dllb1, d3dllc1, d3dlld1, d3dlle1, d3dlle2, d3dllg1, d3dllh1, d3dlli1, d3dllj1, d3dllk1, d3dlll1, d3dllm1, d3dlln1, d3dllo1, d3dllp1, d3dllq1, d3dlls1, d3dllt1, d3dllu1, d3dllv1, d3dllw1, d3dlly1
    automatically matched to 2ZJR R:4-113
    complexed with mg, zld, zn

Details for d3dllr1

PDB Entry: 3dll (more details), 3.5 Å

PDB Description: the oxazolidinone antibiotics perturb the ribosomal peptidyl- transferase center and effect trna positioning
PDB Compounds: (R:) 50S ribosomal protein L24

SCOPe Domain Sequences for d3dllr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dllr1 b.34.5.1 (R:4-113) Ribosomal proteins L24 (L24p) {Deinococcus radiodurans [TaxId: 1299]}
psagshhndklhfkkgdtvivlsgkhkgqtgkvllalprdqkvvvegvnvitknvkpsmt
npqggqeqrelalhaskvalvdpetgkatrvrkqivdgkkvrvavasgkt

SCOPe Domain Coordinates for d3dllr1:

Click to download the PDB-style file with coordinates for d3dllr1.
(The format of our PDB-style files is described here.)

Timeline for d3dllr1: