SCOPe 2.02: Domain d3dllq1: 3dll Q:2-94

Lineage for d3dllq1 (3dll Q:2-94)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
   beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243

4. Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families)

5. Family d.12.1.1: L23p [54190] (1 protein)

6. Protein Ribosomal protein L23 [54191] (4 species)

7. Species Deinococcus radiodurans [TaxId:1299] [159877] (8 PDB entries)
   Uniprot Q9RXK0 2-94

8. Domain d3dllq1: 3dll Q:2-94 [157794]
   Other proteins in same PDB: d3dll11, d3dll21, d3dll31, d3dll41, d3dllb1, d3dllc1, d3dlld1, d3dlle1, d3dlle2, d3dllg1, d3dllh1, d3dlli1, d3dllj1, d3dllk1, d3dlll1, d3dllm1, d3dlln1, d3dllo1, d3dllp1, d3dllr1, d3dlls1, d3dllt1, d3dllu1, d3dllv1, d3dllw1, d3dlly1
   automatically matched to 2ZJR Q:2-94
   complexed with mg, zld, zn

Details for d3dllq1

PDB Entry: 3dll, 3.5 Å

PDB Description: the oxazolidinone antibiotics perturb the ribosomal peptidyl- transferase center and effect trna positioning

PDB Compounds: (Q:) 50S ribosomal protein L23

SCOPe Domain Sequences for d3dllq1:

Sequence; same for both SEQRES and ATOM records:

>d3dllq1 d.12.1.1 (Q:2-94) Ribosomal protein L23 {Deinococcus radiodurans [TaxId: 1299]}
shydilqapvisekaysamergvysfwvspkatkteikdaiqqafgvrvigistmnvpgk
rkrvgrfigqrndrkkaivrlaegqsiealagq

Timeline for d3dllq1:

• d3dllq1 first appeared in SCOP 1.75
  
• d3dllq1 appears in SCOPe 2.01
  
• d3dllq1 appears in SCOPe 2.03
  
• d3dllq1 appears in the current release, SCOPe 2.08