SCOPe 2.02: Domain d3dllp1: 3dll P:8-134

Lineage for d3dllp1 (3dll P:8-134)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
   beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation

4. Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family)
   some topological similarity to prokaryotic ribosomal protein L17

5. Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)

6. Protein Ribosomal protein L22 [54845] (5 species)

7. Species Deinococcus radiodurans [TaxId:1299] [160265] (6 PDB entries)
   Uniprot Q9RXJ7 8-134

8. Domain d3dllp1: 3dll P:8-134 [157793]
   Other proteins in same PDB: d3dll11, d3dll21, d3dll31, d3dll41, d3dllb1, d3dllc1, d3dlld1, d3dlle1, d3dlle2, d3dllg1, d3dllh1, d3dlli1, d3dllj1, d3dllk1, d3dlll1, d3dllm1, d3dlln1, d3dllo1, d3dllq1, d3dllr1, d3dlls1, d3dllt1, d3dllu1, d3dllv1, d3dllw1, d3dlly1
   automatically matched to 2ZJR P:8-134
   complexed with mg, zld, zn

Details for d3dllp1

PDB Entry: 3dll, 3.5 Å

PDB Description: the oxazolidinone antibiotics perturb the ribosomal peptidyl- transferase center and effect trna positioning

PDB Compounds: (P:) 50S ribosomal protein L22

SCOPe Domain Sequences for d3dllp1:

Sequence; same for both SEQRES and ATOM records:

>d3dllp1 d.55.1.1 (P:8-134) Ribosomal protein L22 {Deinococcus radiodurans [TaxId: 1299]}
frnkkqrkqqvklrkpgfavakyvrmsprkvrlvvdvirgksvqdaedllrfiprsasep
vakvlnsakanalhndemledrlfvkeayvdagptlkrliprargsaniikkrtshitii
vaekgnk

Timeline for d3dllp1:

• d3dllp1 first appeared in SCOP 1.75
  
• d3dllp1 appears in SCOPe 2.01
  
• d3dllp1 appears in SCOPe 2.03
  
• d3dllp1 appears in the current release, SCOPe 2.08