Lineage for d3dllo1 (3dll O:5-98)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 813866Fold b.155: L21p-like [141090] (1 superfamily)
    core: sandwich, 6 strands in 2 sheets
  4. 813867Superfamily b.155.1: L21p-like [141091] (1 family) (S)
  5. 813868Family b.155.1.1: Ribosomal protein L21p [141092] (1 protein)
    Pfam PF00829
  6. 813869Protein Ribosomal protein L21p [141093] (3 species)
  7. 813870Species Deinococcus radiodurans [TaxId:1299] [158938] (10 PDB entries)
    Uniprot Q9RY64 5-98
  8. 813876Domain d3dllo1: 3dll O:5-98 [157792]
    Other proteins in same PDB: d3dll11, d3dll21, d3dll31, d3dll41, d3dllb1, d3dllc1, d3dlld1, d3dlle1, d3dlle2, d3dllg1, d3dllh1, d3dlli1, d3dllj1, d3dllk1, d3dlll1, d3dllm1, d3dlln1, d3dllp1, d3dllq1, d3dllr1, d3dlls1, d3dllt1, d3dllu1, d3dllv1, d3dllw1, d3dlly1
    automatically matched to 2ZJR O:5-98
    complexed with mg, zld, zn

Details for d3dllo1

PDB Entry: 3dll (more details), 3.5 Å

PDB Description: the oxazolidinone antibiotics perturb the ribosomal peptidyl- transferase center and effect trna positioning
PDB Compounds: (O:) 50S ribosomal protein L21

SCOP Domain Sequences for d3dllo1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dllo1 b.155.1.1 (O:5-98) Ribosomal protein L21p {Deinococcus radiodurans [TaxId: 1299]}
iqtggkqyrvsegdvirveslqgeagdkvelkalfvggeqtvfgedagkytvqaevvehg
rgkkiyirkyksgvqyrrrtghrqnftaikilgi

SCOP Domain Coordinates for d3dllo1:

Click to download the PDB-style file with coordinates for d3dllo1.
(The format of our PDB-style files is described here.)

Timeline for d3dllo1: