Lineage for d3dllk1 (3dll K:3-115)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1050126Fold d.188: Prokaryotic ribosomal protein L17 [64262] (1 superfamily)
    alpha-beta-alpha(3)-beta(2); 2 layers: alpha/beta;
  4. 1050127Superfamily d.188.1: Prokaryotic ribosomal protein L17 [64263] (1 family) (S)
    some topological similarity to ribosomal protein L22
  5. 1050128Family d.188.1.1: Prokaryotic ribosomal protein L17 [64264] (1 protein)
  6. 1050129Protein Prokaryotic ribosomal protein L17 [64265] (4 species)
  7. 1050130Species Deinococcus radiodurans [TaxId:1299] [160268] (6 PDB entries)
    Uniprot Q9RSJ5 3-115
  8. 1050135Domain d3dllk1: 3dll K:3-115 [157788]
    Other proteins in same PDB: d3dll11, d3dll21, d3dll31, d3dll41, d3dllb1, d3dllc1, d3dlld1, d3dlle1, d3dlle2, d3dllg1, d3dllh1, d3dlli1, d3dllj1, d3dlll1, d3dllm1, d3dlln1, d3dllo1, d3dllp1, d3dllq1, d3dllr1, d3dlls1, d3dllt1, d3dllu1, d3dllv1, d3dllw1, d3dlly1
    automatically matched to 2ZJR K:3-115
    complexed with mg, zld, zn

Details for d3dllk1

PDB Entry: 3dll (more details), 3.5 Å

PDB Description: the oxazolidinone antibiotics perturb the ribosomal peptidyl- transferase center and effect trna positioning
PDB Compounds: (K:) 50S ribosomal protein L17

SCOPe Domain Sequences for d3dllk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dllk1 d.188.1.1 (K:3-115) Prokaryotic ribosomal protein L17 {Deinococcus radiodurans [TaxId: 1299]}
hgkagrklnrnssarvalaraqatallregriqttltkakelrpfveqlittakggdlhs
rrlvaqdihdkdvvrkvmdevapkyaerpggytrilrvgtrrgdgvtmaliel

SCOPe Domain Coordinates for d3dllk1:

Click to download the PDB-style file with coordinates for d3dllk1.
(The format of our PDB-style files is described here.)

Timeline for d3dllk1: