SCOPe 2.02: Domain d3dllg1: 3dll G:30-171

Lineage for d3dllg1 (3dll G:30-171)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.21: Ribosomal protein L13 [52160] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family)

5. Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein)

6. Protein Ribosomal protein L13 [52163] (5 species)
   synonym: 50S ribosomal protein L13p, HMAL13

7. Species Deinococcus radiodurans [TaxId:1299] [159475] (6 PDB entries)
   Uniprot Q9RXY1 30-171

8. Domain d3dllg1: 3dll G:30-171 [157784]
   Other proteins in same PDB: d3dll11, d3dll21, d3dll31, d3dll41, d3dllb1, d3dllc1, d3dlld1, d3dlle1, d3dlle2, d3dllh1, d3dlli1, d3dllj1, d3dllk1, d3dlll1, d3dllm1, d3dlln1, d3dllo1, d3dllp1, d3dllq1, d3dllr1, d3dlls1, d3dllt1, d3dllu1, d3dllv1, d3dllw1, d3dlly1
   automatically matched to 2ZJR G:30-171
   complexed with mg, zld, zn

Details for d3dllg1

PDB Entry: 3dll, 3.5 Å

PDB Description: the oxazolidinone antibiotics perturb the ribosomal peptidyl- transferase center and effect trna positioning

PDB Compounds: (G:) 50S ribosomal protein L13

SCOPe Domain Sequences for d3dllg1:

Sequence; same for both SEQRES and ATOM records:

>d3dllg1 c.21.1.1 (G:30-171) Ribosomal protein L13 {Deinococcus radiodurans [TaxId: 1299]}
ktyipkndeqnwvvvdasgvplgrlatliasrirgkhrpdftpnmiqgdfvvvinaaqva
ltgkklddkvytrytgyqgglktetarealskhperviehavfgmlpkgrqgramhtrlk
vyagethphsaqkpqvlktqpl

Timeline for d3dllg1:

• d3dllg1 first appeared in SCOP 1.75
  
• d3dllg1 appears in SCOPe 2.01
  
• d3dllg1 appears in SCOPe 2.03
  
• d3dllg1 appears in the current release, SCOPe 2.08