SCOPe 2.06: Domain d3dllc1: 3dll C:2-198

Lineage for d3dllc1 (3dll C:2-198)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.22: Ribosomal protein L4 [52165] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.22.1: Ribosomal protein L4 [52166] (1 family)
   automatically mapped to Pfam PF00573

5. Family c.22.1.1: Ribosomal protein L4 [52167] (1 protein)

6. Protein Ribosomal protein L4 [52168] (5 species)
   synonym: 50S ribosomal protein L4e, HMAL4, HL6

7. Species Deinococcus radiodurans [TaxId:1299] [159478] (6 PDB entries)
   Uniprot Q9RXK1 2-198

8. Domain d3dllc1: 3dll C:2-198 [157780]
   Other proteins in same PDB: d3dll11, d3dll21, d3dll31, d3dll41, d3dllb1, d3dlld1, d3dlle1, d3dlle2, d3dllg1, d3dllh1, d3dlli1, d3dllj1, d3dllk1, d3dlll1, d3dllm1, d3dlln1, d3dllo1, d3dllp1, d3dllq1, d3dllr1, d3dlls1, d3dllt1, d3dllu1, d3dllv1, d3dllw1, d3dlly1
   automatically matched to 2ZJR C:2-198
   complexed with mg, zld, zn

Details for d3dllc1

PDB Entry: 3dll, 3.5 Å

PDB Description: the oxazolidinone antibiotics perturb the ribosomal peptidyl- transferase center and effect trna positioning

PDB Compounds: (C:) 50S ribosomal protein L4

SCOPe Domain Sequences for d3dllc1:

Sequence; same for both SEQRES and ATOM records:

>d3dllc1 c.22.1.1 (C:2-198) Ribosomal protein L4 {Deinococcus radiodurans [TaxId: 1299]}
aqinvigqnggrtielplpevnsgvlhevvtwqlasrrrgtastrtraqvsktgrkmygq
kgtgnarhgdrsvptfvgggvafgpkprsydytlprqvrqlglamaiasrqeggklvavd
gfdiadaktknfiswakqngldgtekvllvtddentrraarnvswvsvlpvagvnvydil
rhdrlvidaaaleivee

Timeline for d3dllc1:

• d3dllc1 first appeared in SCOP 1.75
  
• d3dllc1 appears in SCOPe 2.05
  
• d3dllc1 appears in SCOPe 2.07
  
• d3dllc1 appears in the current release, SCOPe 2.08