Lineage for d3dllc1 (3dll C:2-198)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1157938Fold c.22: Ribosomal protein L4 [52165] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 1423
  4. 1157939Superfamily c.22.1: Ribosomal protein L4 [52166] (1 family) (S)
  5. 1157940Family c.22.1.1: Ribosomal protein L4 [52167] (1 protein)
  6. 1157941Protein Ribosomal protein L4 [52168] (5 species)
    synonym: 50S ribosomal protein L4e, HMAL4, HL6
  7. 1157942Species Deinococcus radiodurans [TaxId:1299] [159478] (6 PDB entries)
    Uniprot Q9RXK1 2-198
  8. 1157947Domain d3dllc1: 3dll C:2-198 [157780]
    Other proteins in same PDB: d3dll11, d3dll21, d3dll31, d3dll41, d3dllb1, d3dlld1, d3dlle1, d3dlle2, d3dllg1, d3dllh1, d3dlli1, d3dllj1, d3dllk1, d3dlll1, d3dllm1, d3dlln1, d3dllo1, d3dllp1, d3dllq1, d3dllr1, d3dlls1, d3dllt1, d3dllu1, d3dllv1, d3dllw1, d3dlly1
    automatically matched to 2ZJR C:2-198
    complexed with mg, zld, zn

Details for d3dllc1

PDB Entry: 3dll (more details), 3.5 Å

PDB Description: the oxazolidinone antibiotics perturb the ribosomal peptidyl- transferase center and effect trna positioning
PDB Compounds: (C:) 50S ribosomal protein L4

SCOPe Domain Sequences for d3dllc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dllc1 c.22.1.1 (C:2-198) Ribosomal protein L4 {Deinococcus radiodurans [TaxId: 1299]}
aqinvigqnggrtielplpevnsgvlhevvtwqlasrrrgtastrtraqvsktgrkmygq
kgtgnarhgdrsvptfvgggvafgpkprsydytlprqvrqlglamaiasrqeggklvavd
gfdiadaktknfiswakqngldgtekvllvtddentrraarnvswvsvlpvagvnvydil
rhdrlvidaaaleivee

SCOPe Domain Coordinates for d3dllc1:

Click to download the PDB-style file with coordinates for d3dllc1.
(The format of our PDB-style files is described here.)

Timeline for d3dllc1: