Lineage for d3mdsa1 (3mds A:1-92)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 437311Fold a.2: Long alpha-hairpin [46556] (14 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 437446Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) (S)
  5. 437447Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)
  6. 437559Protein Mn superoxide dismutase (MnSOD) [46618] (6 species)
  7. 437634Species Thermus thermophilus [TaxId:274] [46621] (2 PDB entries)
  8. 437637Domain d3mdsa1: 3mds A:1-92 [15778]
    Other proteins in same PDB: d3mdsa2, d3mdsb2

Details for d3mdsa1

PDB Entry: 3mds (more details), 1.8 Å

PDB Description: maganese superoxide dismutase from thermus thermophilus

SCOP Domain Sequences for d3mdsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mdsa1 a.2.11.1 (A:1-92) Mn superoxide dismutase (MnSOD) {Thermus thermophilus}
pypfklpdlgypyealephidaktmeihhqkhhgayvtnlnaalekypylhgvevevllr
hlaalpqdiqtavrnnggghlnhslfwrlltp

SCOP Domain Coordinates for d3mdsa1:

Click to download the PDB-style file with coordinates for d3mdsa1.
(The format of our PDB-style files is described here.)

Timeline for d3mdsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mdsa2