Lineage for d3dll31 (3dll 3:2-64)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2242290Fold d.301: L35p-like [143033] (1 superfamily)
    core: alpha-beta(3)-alpha; 2layers a/b
  4. 2242291Superfamily d.301.1: L35p-like [143034] (1 family) (S)
    automatically mapped to Pfam PF01632
  5. 2242292Family d.301.1.1: Ribosomal protein L35p [143035] (1 protein)
    Pfam PF01632
  6. 2242293Protein Ribosomal protein L35p [143036] (3 species)
  7. 2242294Species Deinococcus radiodurans [TaxId:1299] [160056] (6 PDB entries)
    Uniprot Q9RSW6 2-64
  8. 2242296Domain d3dll31: 3dll 3:2-64 [157777]
    Other proteins in same PDB: d3dll11, d3dll21, d3dll41, d3dllb1, d3dllc1, d3dlld1, d3dlle1, d3dlle2, d3dllg1, d3dllh1, d3dlli1, d3dllj1, d3dllk1, d3dlll1, d3dllm1, d3dlln1, d3dllo1, d3dllp1, d3dllq1, d3dllr1, d3dlls1, d3dllt1, d3dllu1, d3dllv1, d3dllw1, d3dlly1
    automatically matched to 2ZJR 3:2-64
    complexed with mg, zld, zn

Details for d3dll31

PDB Entry: 3dll (more details), 3.5 Å

PDB Description: the oxazolidinone antibiotics perturb the ribosomal peptidyl- transferase center and effect trna positioning
PDB Compounds: (3:) 50S ribosomal protein L35

SCOPe Domain Sequences for d3dll31:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dll31 d.301.1.1 (3:2-64) Ribosomal protein L35p {Deinococcus radiodurans [TaxId: 1299]}
pkmkthkmakrrikitgtgkvmafksgkrhqntgksgdeirgkgkgfvlakaewarmklm
lpr

SCOPe Domain Coordinates for d3dll31:

Click to download the PDB-style file with coordinates for d3dll31.
(The format of our PDB-style files is described here.)

Timeline for d3dll31: