Lineage for d3dl9b2 (3dl9 B:39-501)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005422Protein Vitamin D 25-hydroxylase Cyp2R1 [158749] (1 species)
  7. 2005423Species Human (Homo sapiens) [TaxId:9606] [158750] (4 PDB entries)
    Uniprot Q6VVX0 39-501
  8. 2005427Domain d3dl9b2: 3dl9 B:39-501 [157771]
    Other proteins in same PDB: d3dl9a3, d3dl9b3
    automated match to d3c6ga1
    complexed with bcd, hem, v2h

Details for d3dl9b2

PDB Entry: 3dl9 (more details), 2.72 Å

PDB Description: crystal structure of cyp2r1 in complex with 1-alpha-hydroxy-vitamin d2
PDB Compounds: (B:) Cytochrome P450 2R1

SCOPe Domain Sequences for d3dl9b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dl9b2 a.104.1.1 (B:39-501) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]}
fppgppglpfigniyslaasselphvymrkqsqvygeifsldlggistvvlngydvvkec
lvhqseifadrpclplfmkmtkmggllnsrygrgwvdhrrlavnsfryfgygqksfeski
leetkffndaietykgrpfdfkqlitnavsnitnliifgerftyedtdfqhmielfsenv
elaasasvflynafpwigilpfgkhqqlfrnaavvydflsrliekasvnrkpqlpqhfvd
ayldemdqgkndpsstfskenlifsvgeliiagtetttnvlrwailfmalypniqgqvqk
eidlimgpngkpswddkckmpyteavlhevlrfcnivplgifhatsedavvrgysipkgt
tvitnlysvhfdekywrdpevfhperfldssgyfakkealvpfslgrrhclgehlarmem
flfftallqrfhlhfphelvpdlkprlgmtlqpqpylicaerr

SCOPe Domain Coordinates for d3dl9b2:

Click to download the PDB-style file with coordinates for d3dl9b2.
(The format of our PDB-style files is described here.)

Timeline for d3dl9b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3dl9b3