SCOPe 2.05: Domain d3dl3i_: 3dl3 I:

Lineage for d3dl3i_ (3dl3 I:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.13: TehB-like [159307] (2 proteins)
   Pfam PF09313; DUF1971

6. Protein Tellurite resistance protein B, TehB [159310] (1 species)

7. Species Vibrio fischeri [TaxId:668] [159311] (1 PDB entry)
   Uniprot Q5E3X2 5-100

8. Domain d3dl3i_: 3dl3 I: [157769]
   automated match to d3dl3a1

Details for d3dl3i_

PDB Entry: 3dl3, 2.3 Å

PDB Description: crystal structure of the tellurite resistance protein tehb. northeast structural genomics consortium target vfr98 .

PDB Compounds: (I:) Tellurite resistance protein B

SCOPe Domain Sequences for d3dl3i_:

Sequence; same for both SEQRES and ATOM records:

>d3dl3i_ b.82.2.13 (I:) Tellurite resistance protein B, TehB {Vibrio fischeri [TaxId: 668]}
hlripknwtiqrstpfftkdnvpeallthhntavdvfgqicvmegvvtyygfanseatep
eikvvinagqfatsppqywhrielsddaqfninfwsdqdksgkkm

Timeline for d3dl3i_:

• d3dl3i_ first appeared in SCOP 1.75, called d3dl3i1
  
• d3dl3i_ appears in SCOPe 2.04
  
• d3dl3i_ appears in SCOPe 2.06
  
• d3dl3i_ appears in the current release, SCOPe 2.08