Lineage for d3dl3i1 (3dl3 I:5-100)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 809734Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 810188Superfamily b.82.2: Clavaminate synthase-like [51197] (13 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 810382Family b.82.2.13: TehB-like [159307] (2 proteins)
    Pfam PF09313; DUF1971
  6. 810383Protein Tellurite resistance protein B, TehB [159310] (1 species)
  7. 810384Species Vibrio fischeri [TaxId:668] [159311] (1 PDB entry)
    Uniprot Q5E3X2 5-100
  8. 810392Domain d3dl3i1: 3dl3 I:5-100 [157769]
    automatically matched to 3DL3 A:5-100

Details for d3dl3i1

PDB Entry: 3dl3 (more details), 2.3 Å

PDB Description: crystal structure of the tellurite resistance protein tehb. northeast structural genomics consortium target vfr98 .
PDB Compounds: (I:) Tellurite resistance protein B

SCOP Domain Sequences for d3dl3i1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dl3i1 b.82.2.13 (I:5-100) Tellurite resistance protein B, TehB {Vibrio fischeri [TaxId: 668]}
ripknwtiqrstpfftkdnvpeallthhntavdvfgqicvmegvvtyygfanseatepei
kvvinagqfatsppqywhrielsddaqfninfwsdq

SCOP Domain Coordinates for d3dl3i1:

Click to download the PDB-style file with coordinates for d3dl3i1.
(The format of our PDB-style files is described here.)

Timeline for d3dl3i1: