Class b: All beta proteins [48724] (174 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (13 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.13: TehB-like [159307] (2 proteins) Pfam PF09313; DUF1971 |
Protein Tellurite resistance protein B, TehB [159310] (1 species) |
Species Vibrio fischeri [TaxId:668] [159311] (1 PDB entry) Uniprot Q5E3X2 5-100 |
Domain d3dl3i1: 3dl3 I:5-100 [157769] automatically matched to 3DL3 A:5-100 |
PDB Entry: 3dl3 (more details), 2.3 Å
SCOP Domain Sequences for d3dl3i1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dl3i1 b.82.2.13 (I:5-100) Tellurite resistance protein B, TehB {Vibrio fischeri [TaxId: 668]} ripknwtiqrstpfftkdnvpeallthhntavdvfgqicvmegvvtyygfanseatepei kvvinagqfatsppqywhrielsddaqfninfwsdq
Timeline for d3dl3i1: