Lineage for d3dl3f_ (3dl3 F:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1807020Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1807787Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 1808075Family b.82.2.13: TehB-like [159307] (2 proteins)
    Pfam PF09313; DUF1971
  6. 1808076Protein Tellurite resistance protein B, TehB [159310] (1 species)
  7. 1808077Species Vibrio fischeri [TaxId:668] [159311] (1 PDB entry)
    Uniprot Q5E3X2 5-100
  8. 1808082Domain d3dl3f_: 3dl3 F: [157766]
    automated match to d3dl3a1

Details for d3dl3f_

PDB Entry: 3dl3 (more details), 2.3 Å

PDB Description: crystal structure of the tellurite resistance protein tehb. northeast structural genomics consortium target vfr98 .
PDB Compounds: (F:) Tellurite resistance protein B

SCOPe Domain Sequences for d3dl3f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dl3f_ b.82.2.13 (F:) Tellurite resistance protein B, TehB {Vibrio fischeri [TaxId: 668]}
shlripknwtiqrstpfftkdnvpeallthhntavdvfgqicvmegvvtyygfanseate
peikvvinagqfatsppqywhrielsddaqfninfwsdqdksgkkmfntk

SCOPe Domain Coordinates for d3dl3f_:

Click to download the PDB-style file with coordinates for d3dl3f_.
(The format of our PDB-style files is described here.)

Timeline for d3dl3f_: