SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3dl3f_ (3dl3 F:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070786Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2071099Family b.82.2.13: TehB-like [159307] (2 protein domains)
    Pfam PF09313; DUF1971
  6. 2071100Protein Tellurite resistance protein B, TehB [159310] (1 species)
  7. 2071101Species Vibrio fischeri [TaxId:668] [159311] (1 PDB entry)
    Uniprot Q5E3X2 5-100
  8. 2071106Domain d3dl3f_: 3dl3 F: [157766]
    automated match to d3dl3a1

Details for d3dl3f_

PDB Entry: 3dl3 (more details), 2.3 Å

PDB Description: Crystal structure of the tellurite resistance protein TehB. Northeast Structural Genomics Consortium target VfR98 .
PDB Compounds: (F:) Tellurite resistance protein B

SCOPe Domain Sequences for d3dl3f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dl3f_ b.82.2.13 (F:) Tellurite resistance protein B, TehB {Vibrio fischeri [TaxId: 668]}
shlripknwtiqrstpfftkdnvpeallthhntavdvfgqicvmegvvtyygfanseate
peikvvinagqfatsppqywhrielsddaqfninfwsdqdksgkkmfntk

SCOPe Domain Coordinates for d3dl3f_:

Click to download the PDB-style file with coordinates for d3dl3f_.
(The format of our PDB-style files is described here.)

Timeline for d3dl3f_: