SCOPe 2.07: Domain d3dknc1: 3dkn C:21-52

Lineage for d3dknc1 (3dkn C:21-52)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.6: Sec-beta or SecG subunit of protein translocation channel [267595] (2 families)

5. Family f.17.6.1: Sec-beta subunit [267608] (1 protein)

6. Protein Sec-beta subunit [267634] (2 species)

7. Species Dog (Canis familiaris) [TaxId:9615] [267694] (1 PDB entry)

8. Domain d3dknc1: 3dkn C:21-52 [157761]
   Other proteins in same PDB: d3dknb1
   automatically matched to d1rh5c_
   protein/RNA complex

Details for d3dknc1

PDB Entry: 3dkn, 8.7 Å

PDB Description: sec61 in the canine ribosome-channel complex from the endoplasmic reticulum

PDB Compounds: (C:) Preprotein translocase subunit secG

SCOPe Domain Sequences for d3dknc1:

Sequence; same for both SEQRES and ATOM records:

>d3dknc1 f.17.6.1 (C:21-52) Sec-beta subunit {Dog (Canis familiaris) [TaxId: 9615]}
etfskirvkpehvigvtvafviieailtygrf

Timeline for d3dknc1:

• d3dknc1 first appeared in SCOP 1.75
  
• d3dknc1 appears in SCOPe 2.06
  
• d3dknc1 appears in the current release, SCOPe 2.08