Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
Superfamily f.17.6: Sec-beta or SecG subunit of protein translocation channel [267595] (2 families) |
Family f.17.6.1: Sec-beta subunit [267608] (1 protein) |
Protein Sec-beta subunit [267634] (2 species) |
Species Dog (Canis familiaris) [TaxId:9615] [267694] (1 PDB entry) |
Domain d3dknc1: 3dkn C:21-52 [157761] Other proteins in same PDB: d3dknb1 automatically matched to d1rh5c_ protein/RNA complex |
PDB Entry: 3dkn (more details), 8.7 Å
SCOPe Domain Sequences for d3dknc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dknc1 f.17.6.1 (C:21-52) Sec-beta subunit {Dog (Canis familiaris) [TaxId: 9615]} etfskirvkpehvigvtvafviieailtygrf
Timeline for d3dknc1: