Lineage for d3dknc1 (3dkn C:21-52)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1956758Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 1956960Superfamily f.17.6: Sec-beta or SecG subunit of protein translocation channel [267595] (2 families) (S)
  5. 1956961Family f.17.6.1: Sec-beta subunit [267608] (1 protein)
  6. 1956962Protein Sec-beta subunit [267634] (2 species)
  7. 1956963Species Dog (Canis familiaris) [TaxId:9615] [267694] (1 PDB entry)
  8. 1956964Domain d3dknc1: 3dkn C:21-52 [157761]
    Other proteins in same PDB: d3dknb1
    automatically matched to d1rh5c_
    protein/RNA complex

Details for d3dknc1

PDB Entry: 3dkn (more details), 8.7 Å

PDB Description: sec61 in the canine ribosome-channel complex from the endoplasmic reticulum
PDB Compounds: (C:) Preprotein translocase subunit secG

SCOPe Domain Sequences for d3dknc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dknc1 f.17.6.1 (C:21-52) Sec-beta subunit {Dog (Canis familiaris) [TaxId: 9615]}
etfskirvkpehvigvtvafviieailtygrf

SCOPe Domain Coordinates for d3dknc1:

Click to download the PDB-style file with coordinates for d3dknc1.
(The format of our PDB-style files is described here.)

Timeline for d3dknc1:

View in 3D
Domains from other chains:
(mouse over for more information)
d3dknb1