SCOPe 2.07: Domain d3dknb1: 3dkn B:2-66

Lineage for d3dknb1 (3dkn B:2-66)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.28: Preprotein translocase SecE subunit [103456] (1 family)

5. Family f.23.28.1: Preprotein translocase SecE subunit [103457] (1 protein)

6. Protein Preprotein translocase SecE subunit [103458] (3 species)

7. Species Dog (Canis familiaris) [TaxId:9615] [161015] (1 PDB entry)

8. Domain d3dknb1: 3dkn B:2-66 [157760]
   Other proteins in same PDB: d3dknc1
   automatically matched to d1rhzb_
   protein/RNA complex

Details for d3dknb1

PDB Entry: 3dkn, 8.7 Å

PDB Description: sec61 in the canine ribosome-channel complex from the endoplasmic reticulum

PDB Compounds: (B:) Preprotein translocase subunit secE

SCOPe Domain Sequences for d3dknb1:

Sequence; same for both SEQRES and ATOM records:

>d3dknb1 f.23.28.1 (B:2-66) Preprotein translocase SecE subunit {Dog (Canis familiaris) [TaxId: 9615]}
tdfnqkieqlkefieecrrvwlvlkkptkdeylavakvtalgisllgiigyiihvpatyi
kgilk

Timeline for d3dknb1:

• d3dknb1 first appeared in SCOP 1.75
  
• d3dknb1 appears in SCOPe 2.06
  
• d3dknb1 appears in the current release, SCOPe 2.08