Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.23: Single transmembrane helix [81407] (40 superfamilies) not a true fold |
Superfamily f.23.28: Preprotein translocase SecE subunit [103456] (1 family) |
Family f.23.28.1: Preprotein translocase SecE subunit [103457] (1 protein) |
Protein Preprotein translocase SecE subunit [103458] (3 species) |
Species Dog (Canis familiaris) [TaxId:9615] [161015] (1 PDB entry) |
Domain d3dknb1: 3dkn B:2-66 [157760] Other proteins in same PDB: d3dknc1 automatically matched to d1rhzb_ protein/RNA complex |
PDB Entry: 3dkn (more details), 8.7 Å
SCOPe Domain Sequences for d3dknb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dknb1 f.23.28.1 (B:2-66) Preprotein translocase SecE subunit {Dog (Canis familiaris) [TaxId: 9615]} tdfnqkieqlkefieecrrvwlvlkkptkdeylavakvtalgisllgiigyiihvpatyi kgilk
Timeline for d3dknb1: