Lineage for d3dknb1 (3dkn B:2-66)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1957421Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
    not a true fold
  4. 1958424Superfamily f.23.28: Preprotein translocase SecE subunit [103456] (1 family) (S)
  5. 1958425Family f.23.28.1: Preprotein translocase SecE subunit [103457] (1 protein)
  6. 1958426Protein Preprotein translocase SecE subunit [103458] (3 species)
  7. 1958427Species Dog (Canis familiaris) [TaxId:9615] [161015] (1 PDB entry)
  8. 1958428Domain d3dknb1: 3dkn B:2-66 [157760]
    Other proteins in same PDB: d3dknc1
    automatically matched to d1rhzb_
    protein/RNA complex

Details for d3dknb1

PDB Entry: 3dkn (more details), 8.7 Å

PDB Description: sec61 in the canine ribosome-channel complex from the endoplasmic reticulum
PDB Compounds: (B:) Preprotein translocase subunit secE

SCOPe Domain Sequences for d3dknb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dknb1 f.23.28.1 (B:2-66) Preprotein translocase SecE subunit {Dog (Canis familiaris) [TaxId: 9615]}
tdfnqkieqlkefieecrrvwlvlkkptkdeylavakvtalgisllgiigyiihvpatyi
kgilk

SCOPe Domain Coordinates for d3dknb1:

Click to download the PDB-style file with coordinates for d3dknb1.
(The format of our PDB-style files is described here.)

Timeline for d3dknb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d3dknc1