Lineage for d3dknb1 (3dkn B:2-66)
- Root: SCOP 1.75
Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) 
Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
not a true fold
Superfamily f.23.28: Preprotein translocase SecE subunit [103456] (1 family) 
Family f.23.28.1: Preprotein translocase SecE subunit [103457] (1 protein) Protein Preprotein translocase SecE subunit [103458] (2 species) 
Species Canis lupus familiaris [TaxId:9615] [161015] (1 PDB entry) 
Domain d3dknb1: 3dkn B:2-66 [157760]
Other proteins in same PDB: d3dknc1
automatically matched to d1rhzb_
Details for d3dknb1
PDB Entry: 3dkn (more details), 8.7 Å
PDB Description: sec61 in the canine ribosome-channel complex from the endoplasmic reticulum
PDB Compounds: (B:) Preprotein translocase subunit secESCOP Domain Sequences for d3dknb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dknb1 f.23.28.1 (B:2-66) Preprotein translocase SecE subunit {Canis lupus familiaris [TaxId: 9615]}
tdfnqkieqlkefieecrrvwlvlkkptkdeylavakvtalgisllgiigyiihvpatyi
kgilk
SCOP Domain Coordinates for d3dknb1:
Click to download the PDB-style file with coordinates for d3dknb1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3dknb1:
- d3dknb1 is new in SCOP 1.75
- d3dknb1 appears in SCOPe 2.01
- d3dknb1 appears in the current release, SCOPe 2.08
View in 3D
