Lineage for d3djbb_ (3djb B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736615Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2736616Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. 2736617Family a.211.1.1: HD domain [101340] (15 proteins)
    Pfam PF01966; metal dependent phosphohydrolases
  6. 2736682Protein Uncharacterized protein BT9727_1981 [158731] (1 species)
  7. 2736683Species Bacillus thuringiensis [TaxId:1428] [158732] (1 PDB entry)
    Uniprot Q6HJG6 2-214
  8. 2736685Domain d3djbb_: 3djb B: [157757]
    automated match to d3djba1
    complexed with mg

Details for d3djbb_

PDB Entry: 3djb (more details), 2.9 Å

PDB Description: crystal structure of a hd-superfamily hydrolase (bt9727_1981) from bacillus thuringiensis, northeast structural genomics consortium target bur114
PDB Compounds: (B:) Hydrolase, HD family

SCOPe Domain Sequences for d3djbb_:

Sequence, based on SEQRES records: (download)

>d3djbb_ a.211.1.1 (B:) Uncharacterized protein BT9727_1981 {Bacillus thuringiensis [TaxId: 1428]}
tkqekiektitfvkhilekdasghdwyhirrvhkmaislseqeggnrfiiemaallhdva
deklneseeagmkkvsdwleelhveeeeskhvlhiianmsykgghggkvesiegklvqda
drldalgaigiartfayggakgrlmydptipprevmtkdeyrknndpslnhfyekllklk
dlmntnaakqeaevrhrymeqfieqfmkewnaq

Sequence, based on observed residues (ATOM records): (download)

>d3djbb_ a.211.1.1 (B:) Uncharacterized protein BT9727_1981 {Bacillus thuringiensis [TaxId: 1428]}
tkqekiektitfvkhilekdasghdwyhirrvhkmaislseqeggnrfiiemaallhdva
dlneseeagmkkvsdwleelhveeeeskhvlhiianmsiegklvqdadrldalgaigiar
tfayggakgrlmydptipprdpslnhfyekllklkdlmntnaakqeaevrhrymeqfieq
fmkewnaq

SCOPe Domain Coordinates for d3djbb_:

Click to download the PDB-style file with coordinates for d3djbb_.
(The format of our PDB-style files is described here.)

Timeline for d3djbb_: