Lineage for d3djbb_ (3djb B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014835Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2014836Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2014837Family a.211.1.1: HD domain [101340] (14 protein domains)
    Pfam PF01966; metal dependent phosphohydrolases
  6. 2014896Protein Uncharacterized protein BT9727_1981 [158731] (1 species)
  7. 2014897Species Bacillus thuringiensis [TaxId:1428] [158732] (1 PDB entry)
    Uniprot Q6HJG6 2-214
  8. 2014899Domain d3djbb_: 3djb B: [157757]
    automated match to d3djba1
    complexed with mg

Details for d3djbb_

PDB Entry: 3djb (more details), 2.9 Å

PDB Description: Crystal structure of a HD-superfamily hydrolase (BT9727_1981) from Bacillus thuringiensis, Northeast Structural Genomics Consortium Target BuR114
PDB Compounds: (B:) Hydrolase, HD family

SCOPe Domain Sequences for d3djbb_:

Sequence, based on SEQRES records: (download)

>d3djbb_ a.211.1.1 (B:) Uncharacterized protein BT9727_1981 {Bacillus thuringiensis [TaxId: 1428]}
tkqekiektitfvkhilekdasghdwyhirrvhkmaislseqeggnrfiiemaallhdva
deklneseeagmkkvsdwleelhveeeeskhvlhiianmsykgghggkvesiegklvqda
drldalgaigiartfayggakgrlmydptipprevmtkdeyrknndpslnhfyekllklk
dlmntnaakqeaevrhrymeqfieqfmkewnaq

Sequence, based on observed residues (ATOM records): (download)

>d3djbb_ a.211.1.1 (B:) Uncharacterized protein BT9727_1981 {Bacillus thuringiensis [TaxId: 1428]}
tkqekiektitfvkhilekdasghdwyhirrvhkmaislseqeggnrfiiemaallhdva
dlneseeagmkkvsdwleelhveeeeskhvlhiianmsiegklvqdadrldalgaigiar
tfayggakgrlmydptipprdpslnhfyekllklkdlmntnaakqeaevrhrymeqfieq
fmkewnaq

SCOPe Domain Coordinates for d3djbb_:

Click to download the PDB-style file with coordinates for d3djbb_.
(The format of our PDB-style files is described here.)

Timeline for d3djbb_: