Lineage for d3dj8a_ (3dj8 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2115321Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2115322Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2115323Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 protein domains)
    Pfam PF00491
  6. 2115567Protein automated matches [190112] (3 species)
    not a true protein
  7. 2115568Species Human (Homo sapiens) [TaxId:9606] [186835] (13 PDB entries)
  8. 2115573Domain d3dj8a_: 3dj8 A: [157753]
    automated match to d1wvaa1
    complexed with exy, mn

Details for d3dj8a_

PDB Entry: 3dj8 (more details), 1.51 Å

PDB Description: Synthesis of (2S)-2-amino-7,8-epoxyoctanoic acid and structure of its metal-bridging complex with human arginase I
PDB Compounds: (A:) Arginase-1

SCOPe Domain Sequences for d3dj8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dj8a_ c.42.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipndspfq
ivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgviwvda
htdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglrdvdpg
ehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsftpatg
tpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavaitlacfg
laregnhkpidyl

SCOPe Domain Coordinates for d3dj8a_:

Click to download the PDB-style file with coordinates for d3dj8a_.
(The format of our PDB-style files is described here.)

Timeline for d3dj8a_: