SCOPe 2.07: Domain d3dika2: 3dik A:11-147

Lineage for d3dika2 (3dik A:11-147)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 protein domains)

6. Protein HIV-1 capsid protein [47945] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (44 PDB entries)

8. Domain d3dika2: 3dik A:11-147 [157752]
   Other proteins in same PDB: d3dika1
   automatically matched to d1e6jp2

Details for d3dika2

PDB Entry: 3dik, 9 Å

PDB Description: Pseudo-atomic model of the HIV-1 CA hexameric lattice

PDB Compounds: (A:) capsid protein p24

SCOPe Domain Sequences for d3dika2:

Sequence; same for both SEQRES and ATOM records:

>d3dika2 a.73.1.1 (A:11-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
vhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlk
etineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmthnppipvgeiy
krwiilglnkivrmysp

Timeline for d3dika2:

• d3dika2 first appeared in SCOP 1.75
  
• d3dika2 appears in SCOPe 2.06