Lineage for d3dika2 (3dik A:11-147)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
core: 5 helices; bundleSuperfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) 
Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins) 
Protein HIV-1 capsid protein [47945] (1 species) Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (62 PDB entries) 
Domain d3dika2: 3dik A:11-147 [157752]
Other proteins in same PDB: d3dika1
automatically matched to d1e6jp2
Details for d3dika2
PDB Entry: 3dik (more details), 9 Å
PDB Description: pseudo-atomic model of the hiv-1 ca hexameric lattice
PDB Compounds: (A:) capsid protein p24SCOPe Domain Sequences for d3dika2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dika2 a.73.1.1 (A:11-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
vhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlk
etineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmthnppipvgeiy
krwiilglnkivrmysp
SCOPe Domain Coordinates for d3dika2:
Click to download the PDB-style file with coordinates for d3dika2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3dika2:
- d3dika2 first appeared in SCOP 1.75
- d3dika2 appears in SCOPe 2.06
View in 3D
