Lineage for d3dika2 (3dik A:11-147)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717816Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2717817Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2717818Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 2717857Protein HIV-1 capsid protein [47945] (1 species)
  7. 2717858Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (70 PDB entries)
  8. 2718000Domain d3dika2: 3dik A:11-147 [157752]
    Other proteins in same PDB: d3dika1
    automatically matched to d1e6jp2

Details for d3dika2

PDB Entry: 3dik (more details)

PDB Description: pseudo-atomic model of the hiv-1 ca hexameric lattice
PDB Compounds: (A:) capsid protein p24

SCOPe Domain Sequences for d3dika2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dika2 a.73.1.1 (A:11-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
vhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlk
etineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmthnppipvgeiy
krwiilglnkivrmysp

SCOPe Domain Coordinates for d3dika2:

Click to download the PDB-style file with coordinates for d3dika2.
(The format of our PDB-style files is described here.)

Timeline for d3dika2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3dika1