|  | Class a: All alpha proteins [46456] (284 folds) | 
|  | Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down | 
|  | Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families)  | 
|  | Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins) | 
|  | Protein HIV capsid protein, dimerisation domain [47359] (1 species) | 
|  | Species Human immunodeficiency virus type 1 [TaxId:11676] [47360] (11 PDB entries) | 
|  | Domain d3dika1: 3dik A:148-219 [157751] Other proteins in same PDB: d3dika2 automatically matched to d1e6jp1 | 
PDB Entry: 3dik (more details), 9 Å
SCOPe Domain Sequences for d3dika1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dika1 a.28.3.1 (A:148-219) HIV capsid protein, dimerisation domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp
gatleemmtacq
Timeline for d3dika1: