Lineage for d3dhzb1 (3dhz B:14-297)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 766018Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 766019Superfamily a.25.1: Ferritin-like [47240] (9 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 766648Family a.25.1.2: Ribonucleotide reductase-like [47253] (8 proteins)
  6. 766797Protein Ribonucleotide reductase R2 [47257] (9 species)
  7. 766810Species Corynebacterium ammoniagenes [TaxId:1697] [69006] (5 PDB entries)
  8. 766812Domain d3dhzb1: 3dhz B:14-297 [157742]
    automatically matched to d1uzrb_
    complexed with fe2

Details for d3dhzb1

PDB Entry: 3dhz (more details), 1.63 Å

PDB Description: apo (iron free) structure of c. ammoniagenes r2 protein
PDB Compounds: (B:) Ribonucleotide reductase subunit R2F

SCOP Domain Sequences for d3dhzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dhzb1 a.25.1.2 (B:14-297) Ribonucleotide reductase R2 {Corynebacterium ammoniagenes [TaxId: 1697]}
dpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtpqeqlatmrvftgl
tlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifmtlastpqineafr
wseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpmylssrakltntad
iirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydlyeneieytediydd
lgwtedvkrflrynankalnnlgyeglfptdetkvspailssls

SCOP Domain Coordinates for d3dhzb1:

Click to download the PDB-style file with coordinates for d3dhzb1.
(The format of our PDB-style files is described here.)

Timeline for d3dhzb1: