SCOP 1.75: Domain d3dhza1: 3dhz A:14-297

Lineage for d3dhza1 (3dhz A:14-297)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (9 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (8 proteins)

6. Protein Ribonucleotide reductase R2 [47257] (9 species)

7. Species Corynebacterium ammoniagenes [TaxId:1697] [69006] (5 PDB entries)

8. Domain d3dhza1: 3dhz A:14-297 [157741]
   automatically matched to d1uzrb_
   complexed with fe2

Details for d3dhza1

PDB Entry: 3dhz, 1.63 Å

PDB Description: apo (iron free) structure of c. ammoniagenes r2 protein

PDB Compounds: (A:) Ribonucleotide reductase subunit R2F

SCOP Domain Sequences for d3dhza1:

Sequence; same for both SEQRES and ATOM records:

>d3dhza1 a.25.1.2 (A:14-297) Ribonucleotide reductase R2 {Corynebacterium ammoniagenes [TaxId: 1697]}
dpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtpqeqlatmrvftgl
tlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifmtlastpqineafr
wseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpmylssrakltntad
iirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydlyeneieytediydd
lgwtedvkrflrynankalnnlgyeglfptdetkvspailssls

Timeline for d3dhza1:

• d3dhza1 is new in SCOP 1.75
  
• d3dhza1 is called d3dhza_ in SCOPe 2.01
  
• d3dhza1 appears in the current release, SCOPe 2.08, called d3dhza_