SCOPe 2.05: Domain d3dhwg2: 3dhw G:241-343

Lineage for d3dhwg2 (3dhw G:241-343)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.18: ACT-like [55021] (15 families)
   regulatory domain linked to a wide range of metabolic enzymes

5. Family d.58.18.13: NIL domain-like [160322] (2 proteins)
   Pfam PF09383

6. Protein Methionine import ATP-binding protein MetN [160323] (2 species)

7. Species Escherichia coli [TaxId:562] [160325] (2 PDB entries)
   Uniprot P30750 241-343! Uniprot P30750 247-343

8. Domain d3dhwg2: 3dhw G:241-343 [157736]
   Other proteins in same PDB: d3dhwa1, d3dhwb1, d3dhwc1, d3dhwd1, d3dhwe1, d3dhwf1, d3dhwg1, d3dhwh1
   automatically matched to 3DHW C:241-343

Details for d3dhwg2

PDB Entry: 3dhw, 3.7 Å

PDB Description: Crystal structure of methionine importer MetNI

PDB Compounds: (G:) Methionine import ATP-binding protein metN

SCOPe Domain Sequences for d3dhwg2:

Sequence; same for both SEQRES and ATOM records:

>d3dhwg2 d.58.18.13 (G:241-343) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]}
iqstlhldipedyqerlqaepftdcvpmlrleftgqsvdapllsetarrfnvnnniisaq
mdyaggvkfgimltemhgtqqdtqaaiawlqehhvkvevlgyv

Timeline for d3dhwg2:

• d3dhwg2 first appeared in SCOP 1.75
  
• d3dhwg2 appears in SCOPe 2.04
  
• d3dhwg2 appears in SCOPe 2.06
  
• d3dhwg2 appears in the current release, SCOPe 2.08