Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology missing some secondary structures that made up less than one-third of the common domain |
Protein Methionine import ATP-binding protein MetN [159571] (1 species) |
Species Escherichia coli [TaxId:562] [159572] (2 PDB entries) Uniprot P30750 1-240 |
Domain d3dhwg1: 3dhw G:1-240 [157735] Other proteins in same PDB: d3dhwa1, d3dhwb1, d3dhwc2, d3dhwd2, d3dhwe1, d3dhwf1, d3dhwg2, d3dhwh2 automatically matched to 3DHW C:1-240 |
PDB Entry: 3dhw (more details), 3.7 Å
SCOPe Domain Sequences for d3dhwg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dhwg1 c.37.1.12 (G:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} miklsnitkvfhqgtrtiqalnnvslhvpagqiygvigasgagkstlircvnllerpteg svlvdgqelttlseseltkarrqigmifqhfnllssrtvfgnvalpleldntpkdevkrr vtellslvglgdkhdsypsnlsggqkqrvaiaralasnpkvllcdeatsaldpattrsil ellkdinrrlgltillithemdvvkricdcvavisngelieqdtvsevfshpktplaqkf
Timeline for d3dhwg1: