Lineage for d1i08d1 (1i08 D:1-90)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 276870Fold a.2: Long alpha-hairpin [46556] (11 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 276989Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) (S)
  5. 276990Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)
  6. 277069Protein Mn superoxide dismutase (MnSOD) [46618] (6 species)
  7. 277080Species Escherichia coli [TaxId:562] [46620] (10 PDB entries)
  8. 277110Domain d1i08d1: 1i08 D:1-90 [15773]
    Other proteins in same PDB: d1i08a2, d1i08b2, d1i08c2, d1i08d2
    complexed with mw1; mutant

Details for d1i08d1

PDB Entry: 1i08 (more details), 2.2 Å

PDB Description: crystal structure analysis of the h30a mutant of manganese superoxide dismutase from e. coli

SCOP Domain Sequences for d1i08d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i08d1 a.2.11.1 (D:1-90) Mn superoxide dismutase (MnSOD) {Escherichia coli}
sytlpslpyaydalephfdkqtmeihhtkahqtyvnnanaaleslpefanlpveelitkl
dqlpadkktvlrnnagghanhslfwkglkk

SCOP Domain Coordinates for d1i08d1:

Click to download the PDB-style file with coordinates for d1i08d1.
(The format of our PDB-style files is described here.)

Timeline for d1i08d1: