SCOPe 2.03: Domain d3dhpa1: 3dhp A:404-496

Lineage for d3dhpa1 (3dhp A:404-496)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Animal alpha-amylase [51024] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51026] (53 PDB entries)
   Uniprot P04746 16-511 ! SQ 04746

8. Domain d3dhpa1: 3dhp A:404-496 [157725]
   Other proteins in same PDB: d3dhpa2
   automatically matched to d1c8qa1
   complexed with ca, cl, glc, hmc

Details for d3dhpa1

PDB Entry: 3dhp, 1.5 Å

PDB Description: probing the role of aromatic residues at the secondary saccharide binding sites of human salivary alpha-amylase in substrate hydrolysis and bacterial binding

PDB Compounds: (A:) Alpha-amylase 1

SCOPe Domain Sequences for d3dhpa1:

Sequence; same for both SEQRES and ATOM records:

>d3dhpa1 b.71.1.1 (A:404-496) Animal alpha-amylase {Human (Homo sapiens) [TaxId: 9606]}
qpftnwydngsnqvafgrgnrgfivfnnddwtfsltlqtglpagtycdvisgdkingnct
gikiyvsddgkahfsisnsaedpfiaihaeskl

Timeline for d3dhpa1:

• d3dhpa1 first appeared in SCOP 1.75
  
• d3dhpa1 appears in SCOPe 2.02
  
• d3dhpa1 appears in SCOPe 2.04
  
• d3dhpa1 appears in the current release, SCOPe 2.08