Lineage for d3dh7c_ (3dh7 C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080001Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2080270Protein Isopentenyl-diphosphate delta-isomerase [89454] (3 species)
  7. 2080276Species Thermus thermophilus HB8 [TaxId:300852] [159377] (1 PDB entry)
  8. 2080279Domain d3dh7c_: 3dh7 C: [157723]
    automated match to d1vcfa1
    complexed with fmn, pop

Details for d3dh7c_

PDB Entry: 3dh7 (more details), 2.97 Å

PDB Description: Structure of T. thermophilus IDI-2 in complex with PPi
PDB Compounds: (C:) Isopentenyl-diphosphate delta-isomerase

SCOPe Domain Sequences for d3dh7c_:

Sequence, based on SEQRES records: (download)

>d3dh7c_ c.1.4.1 (C:) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus HB8 [TaxId: 300852]}
khleaclegevayqktttglegfrlryqalaglalsevdlttpflgktlkapfligamtg
geengerinlalaeaaealgvgmmlgsgrillerpealrsfrvrkvapkallianlglaq
lrrygrddllrlvemleadalafhvnplqeavqrgdtdfrglverlaellplpfpvmvke
vghglsreaalalrdlplaavdvagaggtswarveewvrfgevrhpelceigiptarail
evrevlphlplvasggvytgtdgakalalgadllavarpllrpalegaervaawigdyle
elrtalfaigarnpkeargrverv

Sequence, based on observed residues (ATOM records): (download)

>d3dh7c_ c.1.4.1 (C:) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus HB8 [TaxId: 300852]}
khleaclegevayqktttglegfrlryqalaglalsevdlttpflgktlkapfligamte
rinlalaeaaealgvgmmlgsgrillerpealrrvrkvapkallianlglaqlrrygrdd
llrlvemleadalafhvnplqeavqrgdtdfrglverlaellplpfpvmvkevghglsre
aalalrdlplaavdvagaggtswarveewvrfgevrhpelceigiptarailevrevlph
lplvasggvytgtdgakalalgadllavarpllrpalegaervaawigdyleelrtalfa
igarnpkeargrverv

SCOPe Domain Coordinates for d3dh7c_:

Click to download the PDB-style file with coordinates for d3dh7c_.
(The format of our PDB-style files is described here.)

Timeline for d3dh7c_: