SCOP 1.75: Domain d3dh5a1: 3dh5 A:21-124

Lineage for d3dh5a1 (3dh5 A:21-124)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (1 family)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)

6. Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54079] (154 PDB entries)

8. Domain d3dh5a1: 3dh5 A:21-124 [157720]
   automatically matched to d1rbca_
   complexed with cl, so4

Details for d3dh5a1

PDB Entry: 3dh5, 1.6 Å

PDB Description: crystal structure of bovine pancreatic ribonuclease a (wild-type)

PDB Compounds: (A:) ribonuclease pancreatic

SCOP Domain Sequences for d3dh5a1:

Sequence; same for both SEQRES and ATOM records:

>d3dh5a1 d.5.1.1 (A:21-124) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
sssnycnqmmksrnltkdrckpvntfvhesladvqavcsqknvackngqtncyqsystms
itdcretgsskypncaykttqankhiivacegnpyvpvhfdasv

Timeline for d3dh5a1:

• d3dh5a1 is new in SCOP 1.75
  
• d3dh5a1 is called d3dh5a_ in SCOPe 2.01
  
• d3dh5a1 appears in the current release, SCOPe 2.08, called d3dh5a_