SCOPe 2.02: Domain d3dggb1: 3dgg B:120-219

Lineage for d3dggb1 (3dgg B:120-219)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (172 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

8. Domain d3dggb1: 3dgg B:120-219 [157716]
   Other proteins in same PDB: d3dgga1, d3dgga2, d3dggc1, d3dggc2
   automatically matched to d1fnsh2
   complexed with mg

Details for d3dggb1

PDB Entry: 3dgg, 2.3 Å

PDB Description: crystal structure of fabox108

PDB Compounds: (B:) FabOX108 Heavy Chain Fragment

SCOPe Domain Sequences for d3dggb1:

Sequence, based on SEQRES records:

>d3dggb1 b.1.1.2 (B:120-219) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr

Sequence, based on observed residues (ATOM records):

>d3dggb1 b.1.1.2 (B:120-219) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
akttppsvyplapsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsss
vtvpsstwpsetvtcnvahpasstkvdkkivpr

Timeline for d3dggb1:

• d3dggb1 first appeared in SCOP 1.75
  
• d3dggb1 appears in SCOPe 2.01
  
• d3dggb1 appears in SCOPe 2.03
  
• d3dggb1 appears in the current release, SCOPe 2.08, called d3dggb_