Lineage for d3dgga2 (3dgg A:111-217)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1293251Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 1293252Species Human (Homo sapiens) [TaxId:9606] [88569] (147 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody
  8. 1293306Domain d3dgga2: 3dgg A:111-217 [157715]
    Other proteins in same PDB: d3dgga1, d3dggb1, d3dggc1, d3dggd1
    automatically matched to d1h3pl2
    complexed with mg

Details for d3dgga2

PDB Entry: 3dgg (more details), 2.3 Å

PDB Description: crystal structure of fabox108
PDB Compounds: (A:) FabOX108 Light Chain Fragment

SCOPe Domain Sequences for d3dgga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dgga2 b.1.1.2 (A:111-217) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d3dgga2:

Click to download the PDB-style file with coordinates for d3dgga2.
(The format of our PDB-style files is described here.)

Timeline for d3dgga2: