Lineage for d3dgdc_ (3dgd C:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1113318Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1113483Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 1113484Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
  6. 1113485Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
    sandwich; 8 strands in 2 sheets
  7. 1113506Species Human (Homo sapiens) [TaxId:9606] [49475] (150 PDB entries)
    Uniprot P02766 31-143
  8. 1113539Domain d3dgdc_: 3dgd C: [157712]
    automatically matched to d1gkoa_
    complexed with act, gol, zn; mutant

Details for d3dgdc_

PDB Entry: 3dgd (more details), 1.38 Å

PDB Description: crystal structure of the f87m/l110m mutant of human transthyretin at ph 4.6
PDB Compounds: (C:) Transthyretin

SCOPe Domain Sequences for d3dgdc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dgdc_ b.3.4.1 (C:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispmhehaevvftandsgprrytiaamlspysysttavvtnp

SCOPe Domain Coordinates for d3dgdc_:

Click to download the PDB-style file with coordinates for d3dgdc_.
(The format of our PDB-style files is described here.)

Timeline for d3dgdc_: